These results suggest that endogenous

mCRAMP regulates an

These results suggest that endogenous

mCRAMP regulates antigen-specific IgG1 production in vivo by suppressing CD4+ T-cell IL-4 expression, although whether this is a direct effect or indirect through another cell type is yet to be determined. mCRAMP is an AMP that is beginning to be appreciated as a potent and important immunomodulatory molecule. Rapamycin cost While our data begin to elucidate the role of mCRAMP in the adaptive immune response, more information is needed to fully understand its role in the different microenvironments within the host. It is clear that the cell type producing and/or responding to mCRAMP will partially determine the effect observed. Additional studies are needed to fully understand the role of mCRAMP and other AMPs in the adaptive immune

response. C57BL/6 mice were purchased from the Jackson Laboratory. click here Camp-deficient 129/SVJ mice (Camp−/−, KO) were backcrossed to B6 mice for ten generations and identified by PCR analysis as described previously 8. All mice were maintained under pathogen-free conditions and under approved animal protocols from the Institutional Animal Care and Use Committee at the University of Alabama at Birmingham. The 38 amino acid mCRAMP peptide (ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE) was synthesized by Alpha Diagnostic Int. (San Antonio, TX, USA) and the lyophilized peptides were resuspended in 0.01% acetic acid to generate 100 μM working stocks, which were stored at −80°C until time of use. B-cell purification and activation was performed as described previously 40. Purified splenic B cells were obtained using a CD43 magnetic triclocarban bead depletion strategy (Miltenyi Biotec). B cells (5×104) were cultured in 96-well flat-bottom plates in 200 μL of complete medium (cRPMI). B

cells were stimulated with 20 μg/mL LPS (Sigma-Aldrich), 1 ng/mL recombinant mouse IL-4 (eBioscience), 10 ng/mL recombinant mouse IFN-γ (eBioscience), and/or CD40L-expressing Sf9 cells (a gift from Dr. Virginia Sanders, The Ohio State University) at a B cell-to-Sf9 ratio of 10:1. Culture supernatants were collected and stored at −80°C until further analysis. Flow cytometry and cell sorting was performed as described previously 41. Intracellular staining was performed using the Cytofix/Cytoperm kit (BD Biosciences). FITC-labeled anti-γ1, anti-CD23, anti-Mac-1; PE-labeled anti-CD5, anti-Mac 1, anti-IL-4; APC-labeled anti-B220, PE-Cy7-anti-CD4, PB-anti-B220, PE-anti-IL-4, and PE-rIgG1 isotype antibodies were purchased from BD Pharmingen. Anti-CD21 (clone 7G6) antibody was purified and labeled with PE in our laboratory. Cy5-labeled goat anti-mouse IgM antibody was purchased from Jackson ImmunoResearch. FcR blocker Ab93 was generated in our laboratory 42. Experiments were performed on a FACSCalibur (BD Biosciences), cell sorting using a FACSAria (BD Biosciences), and analysis using FlowJo software (Tree Star). Seven- to nine-wk-old female mice were immunized i.v. with 1×108 heat-killed Streptococcus pneumonia (R36A) or i.p.

Leave a Reply

Your email address will not be published. Required fields are marked *

*

You may use these HTML tags and attributes: <a href="" title=""> <abbr title=""> <acronym title=""> <b> <blockquote cite=""> <cite> <code> <del datetime=""> <em> <i> <q cite=""> <strike> <strong>